Skip to main content
Growth Hormone
99%+ Purity

IGF-1 LR3

Insulin-like Growth Factor 1 Long R3

Published: February 24, 2026 Last updated: February 24, 2026 Reviewed by MVP Peptides Editorial Team

Native IGF-1 is incredible for tissue growth, but its half-life is a pathetic 10 to 20 minutes. Researchers fixed this by adding a 13-amino-acid extension to the N-terminus and swapping glutamic acid for arginine at position 3. The result is IGF-1 LR3, an 83-amino-acid beast that completely evades IGF-binding proteins. You get a half-life of 20 to 30 hours and roughly triple the biological potency of standard IGF-1.

Buy IGF-1 LR3 at Simple Peptide

Purity

99%+

Molecular Weight

9111.4 g/mol

Administration

Subcutaneous or bilateral intramuscular

Storage

Store lyophilized powder at -20°C for up to 3 years

Mechanism of Action

IGF-1 LR3 forces its way into the IGF-1 receptor (IGF-1R) without getting trapped by binding proteins circulating in the blood. Once attached, it flips the switch on the PI3K/Akt pathway to drive massive protein synthesis, and the MAPK pathway to trigger cell division. We are talking about actual muscle hyperplasia—splitting and creating brand new muscle cells—not just inflating existing ones. It also shunts amino acids and glucose directly into muscle tissue, partitioning nutrients entirely away from fat stores.

Sequence:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Chemical Structure

Chemical structure of IGF-1 LR3

Research Areas

  • Skeletal muscle hyperplasia and hypertrophy
  • Cell culture media optimization
  • Myostatin regulation and signaling
  • Nutrient partitioning and glucose metabolism
  • Cartilage and connective tissue regeneration

Potential Benefits

  • Induces muscle cell hyperplasia (new cell creation)
  • Dramatically increases nitrogen retention
  • Drives amino acids directly into muscle tissue
  • Improves recovery time between intense bouts of training
  • Promotes systemic fat loss via nutrient partitioning

Research Dosing Guidelines

For research purposes only. Not for human consumption.

Typical Dose

20-50 mcg

Frequency

Once daily, typically post-workout or first thing in the morning

Duration

4 weeks (strict maximum)

Administration

Subcutaneous or bilateral intramuscular

The community is obsessed with bilateral IM injections into the trained muscle, but the science shows IGF-1 LR3 goes systemic regardless of where you pin it. Receptor desensitization hits a brick wall at about 4 weeks. If you run it longer, you are just wasting biological pathways and risking insulin resistance. Reconstitute with 0.6% acetic acid, as standard bacteriostatic water degrades LR3.

Reconstitution Calculator

mg
mcg
2.0 ml
0.5 ml5 ml

U-100 Insulin Syringe

0102030405060708090100

40.0 units

Concentration

50 mcg/ml

Inject Volume

0.400 ml

Syringe Units

40.0 IU

Doses Per Vial

5

For research and educational purposes only. Always follow proper reconstitution and sterile handling protocols.

IGF-1 LR3 vs MGF vs PEG-MGF: Growth Factor Comparison

These three growth factor peptides operate on related but distinct pathways in muscle tissue. Choosing the right one depends on whether the research goal is cell growth, cell multiplication, or both.

Growth Factor Comparison

FactorIGF-1 LR3MGF (Base)PEG-MGF
Primary actionDifferentiation + hypertrophySatellite cell proliferationSatellite cell proliferation (sustained)
Half-life20-30 hours~5 minutesSeveral days
Dosing20-50 mcg/day100-200 mcg post-workout200-400 mcg 2-3x/week
AdministrationSubQ or bilateral IMBilateral IM (trained muscle)SubQ (systemic)
Cycle length4 weeks maximum4-6 weeks4-6 weeks
Hypoglycemia riskHighMildLow

The optimal research protocol sequences MGF first (to expand the satellite cell pool) followed by IGF-1 LR3 (to differentiate and mature those new cells). Running them simultaneously creates receptor competition and diminishes the effect of both.

Potential Side Effects

  • Hypoglycemia (crashing blood sugar)
  • Receptor downregulation after 4 weeks
  • Lethargy and extreme training fatigue
  • Water retention
  • Theoretical acceleration of existing tumor growth

Storage Requirements

Store lyophilized powder at -20°C for up to 3 years. Reconstitute with 0.6% acetic acid and keep at 2-8°C for up to 30 days.

Research References

Frequently Asked Questions

What is IGF-1 LR3?

IGF-1 LR3 is a synthetic, 83-amino-acid analog of human Insulin-like Growth Factor 1. By adding a 13-amino-acid extension and modifying the third amino acid, researchers created a version that ignores IGF-binding proteins. This extends its half-life from 20 minutes to over 24 hours.

What are the potential research benefits of IGF-1 LR3?

The primary draw in research is skeletal muscle hyperplasia, meaning the creation of completely new muscle cells rather than just expanding existing ones. It also aggressively partitions nutrients, driving glucose and amino acids into muscle tissue while mobilizing stored fat.

How is IGF-1 LR3 typically dosed in research?

Research protocols generally cap at 20 to 50 mcg per day, administered subcutaneously or intramuscularly. Cycles are strictly limited to 4 weeks because IGF-1 receptors downregulate rapidly, rendering the compound useless if pushed longer.

What are the side effects of IGF-1 LR3?

Because it heavily impacts glucose metabolism, hypoglycemia is a real and immediate risk if subjects aren't fed properly. Other reported issues include severe lethargy, fluid retention, and the potential acceleration of any pre-existing cellular mutations or tumors.

How should IGF-1 LR3 be stored?

Lyophilized powder goes in the freezer at -20°C. Once reconstituted, it must be stored in the refrigerator at 2-8°C, and frankly, you should be using 0.6% acetic acid for reconstitution because bacteriostatic water degrades LR3 very quickly.

Ready to Purchase IGF-1 LR3?

Get the highest quality IGF-1 LR3 from our recommended vendor with 99%+ purity guaranteed.

Buy at Simple Peptide

Related Peptides

CJC-1295

CJC-1295 (with or without DAC)

CJC-1295 is a synthetic 29-amino-acid analog of growth hormone-releasing hormone (GHRH), originally developed by ConjuChem Biotechnologies. It stimulates the pituitary gland to release growth hormone in a dose-dependent manner. It comes in two forms: with DAC (Drug Affinity Complex), which uses a maleimidopropionic acid linker to bind the peptide to serum albumin and extend its half-life to roughly 8 days, and without DAC (also called Mod GRF 1-29), which has a half-life of about 30 minutes and produces sharper, more natural GH pulses.

Learn More

Ipamorelin

Ipamorelin Acetate

Ipamorelin is a selective growth hormone secretagogue and ghrelin receptor agonist. It is known for producing a clean growth hormone release without significantly affecting cortisol or prolactin levels, making it one of the safest GH-releasing peptides.

Learn More

Tesamorelin

Tesamorelin Acetate

Tesamorelin is a synthetic form of growth hormone-releasing hormone (GHRH). It is FDA-approved for reducing excess abdominal fat in HIV patients with lipodystrophy. It has become of interest for its ability to reduce visceral adipose tissue.

Learn More

MGF

Mechano Growth Factor (MGF)

Mechano Growth Factor (MGF) is an alternative splice variant of the IGF-1 gene, specifically known as IGF-1Ec in humans. Geoffrey Goldspink's lab nailed this discovery in the late 90s when they realized muscle tissue expresses a unique growth factor in direct response to physical stretch and mechanical overload. Most of what you buy as "MGF" is actually just the 24-amino acid C-terminal sequence of this variant. Base MGF has a half-life of mere minutes, making it trickier to use than its pegylated cousin (PEG-MGF), but purists still prefer this base version for targeted, immediate post-workout applications.

Learn More