Skip to main content
Recovery
Popular
99%+ Purity

TB-500

Thymosin Beta-4

Published: April 30, 2025 Last updated: May 21, 2025 Reviewed by MVP Peptides Editorial Team

TB-500 is a synthetic version of the naturally occurring peptide Thymosin Beta-4. It plays a crucial role in tissue repair, regeneration, and protection. TB-500 is known for its ability to promote healing, reduce inflammation, and improve flexibility.

Buy TB-500 at Peptide Palace

Purity

99%+

Molecular Weight

4963.5 g/mol

Administration

Subcutaneous or intramuscular injection

Storage

Store lyophilized powder at -20°C

Mechanism of Action

TB-500 upregulates cell-building proteins such as actin, which is involved in cell migration and proliferation. It promotes angiogenesis, reduces inflammation, and helps with tissue remodeling. It also has anti-inflammatory properties through modulation of cytokine expression.

Sequence:

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Chemical Structure

Chemical structure of TB-500

Research Areas

  • Cardiac repair
  • Wound healing
  • Hair regrowth
  • Muscle repair
  • Corneal repair

Potential Benefits

  • Enhanced tissue repair
  • Reduced inflammation
  • Improved flexibility
  • Accelerated recovery
  • Cardiovascular support

Research Dosing Guidelines

For research purposes only. Not for human consumption.

Typical Dose

2-2.5 mg

Frequency

2 times per week (loading), weekly (maintenance)

Duration

4-8 weeks

Administration

Subcutaneous or intramuscular injection

Often used in conjunction with BPC-157 for synergistic effects in research settings.

Reconstitution Calculator

mg
mcg
2.0 ml
0.5 ml5 ml

U-100 Insulin Syringe

0102030405060708090100

0.1 units

Concentration

2500 mcg/ml

Inject Volume

0.0008 ml

Syringe Units

0.1 IU

Doses Per Vial

2500

For research and educational purposes only. Always follow proper reconstitution and sterile handling protocols.

TB-500 vs BPC-157: Choosing the Right Healing Peptide

TB-500 and BPC-157 are frequently compared as the two leading tissue-repair peptides. While they share a healing focus, their mechanisms and ideal use cases differ substantially.

Head-to-Head Comparison

FactorTB-500BPC-157
MechanismUpregulates actin for cell migrationPromotes angiogenesis and NO synthesis
Best forMuscle tears, cardiac repair, flexibilityTendon/ligament injuries, gut healing
Systemic reachHighly systemicMore localized when injected near site
Dosing frequency2x/week1-2x/day
Typical dose2-2.5 mg250-500 mcg
StackingCommonly stacked with BPC-157Commonly stacked with TB-500

Many researchers run both peptides simultaneously for synergistic healing effects. TB-500 provides broad, systemic tissue repair while BPC-157 targets specific injury sites with more localized action.

Potential Side Effects

  • Head rush or lethargy (temporary)
  • Injection site irritation
  • Flu-like symptoms (rare)

Storage Requirements

Store lyophilized powder at -20°C. Reconstituted solution at 2-8°C for up to 2 weeks.

Research References

  • [1]
    Thymosin β4 and Tissue Repair (2012)
    Preclinical Population: Preclinical models and clinical wound studies

    Thymosin beta-4 promotes wound healing through upregulation of actin, angiogenesis, and anti-inflammatory activity.

    Limitations: Limited controlled human trial data

  • [2]
    Thymosin Beta-4: Actin-Sequestering Protein in Tissue Repair (2005)
    Preclinical Population: In-vitro cell models

    Established thymosin beta-4 as the primary intracellular actin-sequestering protein critical for cell migration and tissue repair.

    Limitations: Mechanistic review; indirect clinical applicability

  • [3]
    Advances in Basic and Clinical Applications of Thymosin β4 (2015)
    Preclinical Population: Multiple preclinical and early clinical models

    Demonstrated therapeutic potential of thymosin beta-4 across cardiac repair, dermal wound healing, and corneal regeneration.

    Limitations: Heterogeneous study designs; lacks Phase III trial data

Frequently Asked Questions

What is TB-500?

TB-500 is a synthetic version of the naturally occurring peptide Thymosin Beta-4, which plays a crucial role in tissue repair, regeneration, and protection. It is widely studied for its ability to promote healing, reduce inflammation, and improve flexibility in research models.

What are the potential research benefits of TB-500?

Research indicates TB-500 may enhance tissue repair, reduce inflammation, improve flexibility, and support cardiovascular health. It promotes angiogenesis and cell migration through upregulation of actin, a key cell-building protein involved in proliferation.

How is TB-500 typically dosed in research?

TB-500 is typically dosed at 2-2.5 mg via subcutaneous or intramuscular injection, administered twice weekly during a loading phase and weekly for maintenance. Research cycles generally last 4-8 weeks, and it is often combined with BPC-157 for synergistic effects.

What are the side effects of TB-500?

TB-500 may cause temporary head rush or lethargy, injection site irritation, and rarely flu-like symptoms. Overall, it is considered well-tolerated in research settings with a favorable safety profile.

How should TB-500 be stored?

TB-500 should be stored as lyophilized powder at -20°C for long-term preservation. Once reconstituted, the solution should be kept at 2-8°C and used within two weeks.

Ready to Purchase TB-500?

Get the highest quality TB-500 from our recommended vendor with 99%+ purity guaranteed.

Buy at Peptide Palace

Related Peptides

BPC-157

Body Protection Compound-157

BPC-157 is a pentadecapeptide composed of 15 amino acids. It is a partial sequence of body protection compound (BPC) that is discovered in and isolated from human gastric juice. Research has shown it accelerates the healing of many different wounds, including tendon-to-bone healing and superior healing of damaged ligaments.

Learn More

GHK-Cu

Copper Peptide GHK-Cu

GHK-Cu is a naturally occurring copper complex of the tripeptide glycyl-L-histidyl-L-lysine. It has extensive research supporting its role in wound healing, skin regeneration, and anti-aging effects. GHK-Cu levels decline with age, which has led to interest in supplementation.

Learn More