Skip to main content
Immune
99%+ Purity

LL-37

Cathelicidin Antimicrobial Peptide LL-37

Published: January 17, 2026 Last updated: February 7, 2026 Reviewed by MVP Peptides Editorial Team

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans. It is a 37-amino-acid peptide cleaved from the C-terminal end of the human cathelicidin protein hCAP18. LL-37 plays a central role in innate immune defense against bacterial, viral, and fungal infections.

Buy LL-37 at Simple Peptide

Purity

99%+

Molecular Weight

4493.33 g/mol

Administration

Subcutaneous injection or topical application

Storage

Store at -20°C lyophilized

Mechanism of Action

LL-37 disrupts microbial membranes through electrostatic interactions with negatively charged lipid bilayers. Beyond direct antimicrobial activity, it modulates the immune response by promoting chemotaxis of immune cells, stimulating angiogenesis, enhancing wound healing, and modulating inflammatory cytokine production. It can also neutralize bacterial endotoxins (LPS).

Sequence:

[LL-37, 37 aa]

Chemical Structure

Chemical structure of LL-37

Research Areas

  • Antimicrobial defense and innate immunity
  • Wound healing and tissue repair
  • Biofilm disruption
  • Anti-inflammatory modulation
  • Cancer immunotherapy adjuncts

Potential Benefits

  • Broad-spectrum antimicrobial activity
  • Enhanced innate immune response
  • Accelerated wound healing
  • Biofilm disruption capability
  • Immune modulation and LPS neutralization

Research Dosing Guidelines

For research purposes only. Not for human consumption.

Typical Dose

50-100 mcg

Frequency

As needed or 2-3 times weekly

Duration

Variable based on research protocol

Administration

Subcutaneous injection or topical application

Dosing protocols are not well established. Research peptide with limited human dosing data. Use only under medical supervision.

Reconstitution Calculator

mg
mcg
2.0 ml
0.5 ml5 ml

U-100 Insulin Syringe

0102030405060708090100

2.0 units

Concentration

2500 mcg/ml

Inject Volume

0.020 ml

Syringe Units

2.0 IU

Doses Per Vial

100

For research and educational purposes only. Always follow proper reconstitution and sterile handling protocols.

LL-37 Antimicrobial Spectrum

LL-37 provides remarkably broad antimicrobial coverage compared to conventional antibiotics, acting through membrane disruption rather than metabolic targets.

Antimicrobial Activity

Pathogen TypeActivity LevelMechanism
Gram-positive bacteriaStrongMembrane disruption and pore formation
Gram-negative bacteriaStrongLPS binding and outer membrane destabilization
Biofilm-forming bacteriaModerate-StrongBiofilm matrix disruption and penetration
Fungi (Candida)ModerateFungal membrane disruption
Enveloped virusesModerateViral envelope disruption
MycobacteriaLimitedIntracellular killing via autophagy promotion

LL-37's membrane-targeting mechanism makes resistance development unlikely compared to conventional antibiotics. Its ability to disrupt established biofilms adds particular clinical interest for chronic wound and implant-associated infections.

Potential Side Effects

  • Injection site irritation
  • Local inflammatory response at high doses
  • Limited human safety data for systemic use
  • Potential mast cell activation at high concentrations

Storage Requirements

Store at -20°C lyophilized. Reconstituted at 2-8°C. Avoid repeated freeze-thaw cycles.

Research References

  • [1]
    LL-37: The Only Human Member of the Cathelicidin Family (2003)
    Preclinical Population: In-vitro microbial culture studies

    LL-37 demonstrates broad-spectrum antimicrobial activity against bacteria, fungi, and enveloped viruses through membrane disruption.

    Limitations: In-vitro antimicrobial efficacy may not translate to systemic clinical use

  • [2]
    Antimicrobial Peptides in Human Health and Disease (2006)
    Preclinical Population: Comprehensive review of human antimicrobial peptide biology

    Antimicrobial peptides including LL-37 serve dual roles as direct pathogen killers and immune system modulators.

    Limitations: Broad review; specific therapeutic dosing for LL-37 not addressed

Frequently Asked Questions

What is LL-37?

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans, consisting of 37 amino acids cleaved from the human cathelicidin protein hCAP18. It plays a central role in innate immune defense against bacterial, viral, and fungal infections.

What are the potential research benefits of LL-37?

Research indicates LL-37 provides broad-spectrum antimicrobial activity, enhances innate immune response, accelerates wound healing, and can disrupt bacterial biofilms. It also demonstrates immune modulation capabilities including neutralization of bacterial endotoxins (LPS).

How is LL-37 typically dosed in research?

LL-37 is typically administered at 50-100 mcg via subcutaneous injection or topical application, two to three times weekly as needed. Dosing protocols are not yet well established, and research use requires careful protocol design given limited human dosing data.

What are the side effects of LL-37?

Potential side effects of LL-37 include injection site irritation, local inflammatory response at high doses, and potential mast cell activation at high concentrations. Limited human safety data exists for systemic use of this antimicrobial peptide.

How should LL-37 be stored?

LL-37 should be stored at -20°C in lyophilized form and refrigerated at 2-8°C once reconstituted. Repeated freeze-thaw cycles should be avoided to maintain the peptide's antimicrobial activity and structural integrity.

Ready to Purchase LL-37?

Get the highest quality LL-37 from our recommended vendor with 99%+ purity guaranteed.

Buy at Simple Peptide

Related Peptides

BPC-157

Body Protection Compound-157

BPC-157 is a pentadecapeptide composed of 15 amino acids. It is a partial sequence of body protection compound (BPC) that is discovered in and isolated from human gastric juice. Research has shown it accelerates the healing of many different wounds, including tendon-to-bone healing and superior healing of damaged ligaments.

Learn More

Thymosin Alpha-1

Thymosin Alpha-1

Thymosin Alpha-1 is a peptide naturally produced by the thymus gland. It plays a crucial role in immune system regulation and has been approved in many countries for treatment of hepatitis B and C, and as an adjunct to cancer therapy.

Learn More